PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000902822
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 314aa    MW: 36330.5 Da    PI: 6.586
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000902822genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.82.5e-5451331128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                    +ppGfrFhPt+eelv +yLk+k+++ +++l +vi ++d+yk+ePwd+++     ++e++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk+vl
  MDP0000902822   5 VPPGFRFHPTEEELVGYYLKRKINSLQIDL-DVIVDIDLYKIEPWDIQArckLGYSEKNEWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAVL 99 
                    69****************************.99**************953432234677************************************* PP

            NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                    s k++ +g++ktLvfykgrap+g+ktdW+mheyrl
  MDP0000902822 100 S-KNNIIGMRKTLVFYKGRAPNGNKTDWIMHEYRL 133
                    *.8899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.75E-603154IPR003441NAC domain
PROSITE profilePS5100558.1085154IPR003441NAC domain
PfamPF023651.0E-286133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MESCVPPGFR FHPTEEELVG YYLKRKINSL QIDLDVIVDI DLYKIEPWDI QARCKLGYSE  60
KNEWYFFSHK DKKYPTGTRT NRATAAGFWK ATGRDKAVLS KNNIIGMRKT LVFYKGRAPN  120
GNKTDWIMHE YRLQTSEHAP PQEEGWVVCR AFKKPSPSHR QGFEAWKHAY YVRDHPSSSS  180
FSSEMPMAML INPNQGFHQP FRSDQQDHFV SNNIFLGNQL MELPQLESPT ISTSFVTQEN  240
ILNSNNLSTE DYEDDRSNNN NSNQQIDWKN LDNLLEVQLT DRASFSHPSL SSGPQYYEQE  300
TRSNHLLGCF QDL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-49215412168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ9199620.0KJ919962.1 Eriobotrya japonica NAC1 transcription factor (NAC1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008380992.10.0PREDICTED: NAC domain-containing protein 7
SwissprotQ9C8W91e-116NAC30_ARATH; NAC domain-containing protein 30
TrEMBLA0A0H3VAL90.0A0A0H3VAL9_9R
STRINGPOPTR_0019s11330.11e-145(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF71383247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71930.16e-97vascular related NAC-domain protein 7